Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens FXYD domain containing ion transport regulator 2 (FXYD2), transcript variant a (NM_001680). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P54710 |
| Entry Name | ATNG_HUMAN |
| Gene Names | FXYD2 ATP1C ATP1G1 |
| Alternative Gene Names | ATP1C ATP1G1 |
| Alternative Protein Names | Sodium/potassium-transporting ATPase subunit gamma (Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 66 |
| Molecular Weight(Da) | 7283 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Background
| Function | FUNCTION: May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase. |
| Pathway | |
| Protein Families | FXYD family |
| Tissue Specificity | Expressed in the distal convoluted tubule in the kidney. Found on basolateral membranes of nephron epithelial cells. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |